Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL-23 protein

This Human IL-23 protein spans the amino acid sequence from region 20-189aa & 23-328aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2

UniProt

Q9NPF7, P29460

Expression Region

20-189aa&23-328aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to induce STAT reporter activity in 293F human embryonic kidney cells is 70-210 ng/ml.

Form

Lyophilized powder

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Heterodimer

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Reduced glutathione ELISA Kit
MBS724815-01 48 Well

Mouse Reduced glutathione ELISA Kit

Sign In for Pricing
View Details
Mouse Reduced glutathione ELISA Kit
MBS724815-02 96 Well

Mouse Reduced glutathione ELISA Kit

Sign In for Pricing
View Details
Mouse Reduced glutathione ELISA Kit
MBS724815-03 5x 96 Well

Mouse Reduced glutathione ELISA Kit

Sign In for Pricing
View Details
Mouse Reduced glutathione ELISA Kit
MBS724815-04 10x 96 Well

Mouse Reduced glutathione ELISA Kit

Sign In for Pricing
View Details
PDE6A Peptide - middle region
MBS3245153-01 0.1 mg

PDE6A Peptide - middle region

Sign In for Pricing
View Details
PDE6A Peptide - middle region
MBS3245153-02 5x 0.1 mg

PDE6A Peptide - middle region

Sign In for Pricing
View Details