Human IL13 protein
This Human IL13 protein spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Interleukin-13; IL-13
Expression Region
25-146aa
Tag
C-terminal 6xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 1.5-4.5 ng/ml.
Form
Lyophilized powder
Molecular Weight
13.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
Lyophilized from a 0.2 μm filtered solution of PBS, PH7.4.
AA Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1454737-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana IAA-amino acid hydrolase ILR1-like 5 (ILL5)
Sign In for Pricing
View Details MBS1454737-02 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana IAA-amino acid hydrolase ILR1-like 5 (ILL5)
Sign In for Pricing
View Details MBS1454737-03 0.1 mg (E-Coli)
Recombinant Arabidopsis thaliana IAA-amino acid hydrolase ILR1-like 5 (ILL5)
Sign In for Pricing
View Details MBS1454737-04 0.1 mg (Yeast)
Recombinant Arabidopsis thaliana IAA-amino acid hydrolase ILR1-like 5 (ILL5)
Sign In for Pricing
View Details MBS1454737-05 0.02 mg (Baculovirus)
Recombinant Arabidopsis thaliana IAA-amino acid hydrolase ILR1-like 5 (ILL5)
Sign In for Pricing
View Details