Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL13 protein

This Human IL13 protein spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-13; IL-13

Expression Region

25-146aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 1.5-4.5 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered solution of PBS, PH7.4.

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPPA4 (Developmental Pluripotency-Associated Protein 4, FLJ10713) (HRP)
MBS6376550-01 0.1 mL

DPPA4 (Developmental Pluripotency-Associated Protein 4, FLJ10713) (HRP)

Sign In for Pricing
View Details
DPPA4 (Developmental Pluripotency-Associated Protein 4, FLJ10713) (HRP)
MBS6376550-02 5x 0.1 mL

DPPA4 (Developmental Pluripotency-Associated Protein 4, FLJ10713) (HRP)

Sign In for Pricing
View Details
Pooled Human AB Serum Plasma Derived Heat Inactivated Gamma Irradiated 100ml
ISERABHIGI100ML 100 mL

Pooled Human AB Serum Plasma Derived Heat Inactivated Gamma Irradiated 100ml

Sign In for Pricing
View Details
RPL32 Antibody
orb2682779-01 50 µL

RPL32 Antibody

Sign In for Pricing
View Details
RPL32 Antibody
orb2682779-02 100 µL

RPL32 Antibody

Sign In for Pricing
View Details
RPL32 Antibody
orb2682779-03 200 µL

RPL32 Antibody

Sign In for Pricing
View Details