Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL13 protein

This Human IL13 protein spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-13; IL-13

Expression Region

25-146aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 1.5-4.5 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered solution of PBS, PH7.4.

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ICOS Alexa Fluor 488 MAb (2317C)
FAB1682G-100UG 100 µg

Mouse ICOS Alexa Fluor 488 MAb (2317C)

Sign In for Pricing
View Details
Lentiviral mouse Pop1 shRNA (UAS) - Lentiviral mouse Pop1 shRNA (UAS) (25)
GTR15216221 1 Vial

Lentiviral mouse Pop1 shRNA (UAS) - Lentiviral mouse Pop1 shRNA (UAS) (25)

Sign In for Pricing
View Details
MATN1 (NM_002379) Human Over-expression Lysate
LS004146-100ug 100 µg

MATN1 (NM_002379) Human Over-expression Lysate

Sign In for Pricing
View Details
N-[2- (2-Methoxyphenoxy) ethyl]benzylamine
282241-01 50 mg

N-[2- (2-Methoxyphenoxy) ethyl]benzylamine

Sign In for Pricing
View Details
N-[2- (2-Methoxyphenoxy) ethyl]benzylamine
282241-02 100 mg

N-[2- (2-Methoxyphenoxy) ethyl]benzylamine

Sign In for Pricing
View Details
N-[2- (2-Methoxyphenoxy) ethyl]benzylamine
282241-03 250 mg

N-[2- (2-Methoxyphenoxy) ethyl]benzylamine

Sign In for Pricing
View Details