Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TGFB2 protein

This Human TGFB2 protein spans the amino acid sequence from region 303-414aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transforming growth factor beta-2; TGFB2; Polyergin; G-TSF; Glioblastoma-derived T-cell suppressor factor; Cetermin; BSC-1 cell growth inhibitor; TGF-beta-2

UniProt

P61812

Expression Region

303-414aa

Tag

Tag-Free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 cells is 30-180pg/ml.

Form

Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 4 mM HCl

AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCFC1R1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23071154 3x 1.0 µg DNA

HCFC1R1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CLCN1 (Chloride Channel 1, CLC1) discontinued
210161-01 20 µL

CLCN1 (Chloride Channel 1, CLC1) discontinued

Sign In for Pricing
View Details
CLCN1 (Chloride Channel 1, CLC1) discontinued
210161-02 100 µL

CLCN1 (Chloride Channel 1, CLC1) discontinued

Sign In for Pricing
View Details
Lyar Antibody
GWB-MU650B 50 µg

Lyar Antibody

Sign In for Pricing
View Details
PAX5 Rabbit Monoclonal Antibody
E56G1691 100 µL

PAX5 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium MAV_4644 Protein (aa 1-825)
VAng-Yyj2638-inquire Inquire

Recombinant Mycobacterium Avium MAV_4644 Protein (aa 1-825)

Sign In for Pricing
View Details