Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF1 protein

This Human FGF1 protein spans the amino acid sequence from region 16-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Endothelial Cell Growth Factor; ECGFHeparin-Binding Growth Factor 1; HBGF-1; FGF1; FGFA

UniProt

P05230

Expression Region

16-155aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.2-2 ng/ml.

Form

Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris, 400 mM NaCl, 1 mM DTT, pH 8.0

AA Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Human IgE Fc-PE
MBS679445-01 0.1 mg

Mouse Anti-Human IgE Fc-PE

Sign In for Pricing
View Details
Mouse Anti-Human IgE Fc-PE
MBS679445-02 5x 0.1 mg

Mouse Anti-Human IgE Fc-PE

Sign In for Pricing
View Details
Recombinant Human ROR2 Protein, N-GST
HX930012-01 50 µg

Recombinant Human ROR2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human ROR2 Protein, N-GST
HX930012-02 100 µg

Recombinant Human ROR2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human ROR2 Protein, N-GST
HX930012-03 1 mg

Recombinant Human ROR2 Protein, N-GST

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)
MBS2006751-01 0.1 mL

Polyclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)

Sign In for Pricing
View Details