Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompA protein

This E. coli ompA protein spans the amino acid sequence from region 22-346aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer membrane protein II* (con) (tolG) (tut)

UniProt

P0A910

Expression Region

22-346aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oas1c sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4095002 1.0 µg DNA

Oas1c sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit anti-human huntingtin interacting protein 1 polyclonal Antibody
MBS713636-01 0.1 mL

Rabbit anti-human huntingtin interacting protein 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human huntingtin interacting protein 1 polyclonal Antibody
MBS713636-02 5x 0.1 mL

Rabbit anti-human huntingtin interacting protein 1 polyclonal Antibody

Sign In for Pricing
View Details
Caspase-9/CASP9 Rabbit Polyclonal Antibody (APC)
orb2622347 100 µg

Caspase-9/CASP9 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
SLC30A8 Antibody
GWB-MR003C 50 µg

SLC30A8 Antibody

Sign In for Pricing
View Details
FOXJ3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
20778124 3x 1.0µg DNA

FOXJ3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details