Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompA protein

This E. coli ompA protein spans the amino acid sequence from region 22-346aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer membrane protein II* (con) (tolG) (tut)

UniProt

P0A910

Expression Region

22-346aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (Thyroidal Cell Marker) Antibody
orb1712757 0.1 mL

Thyroglobulin (Thyroidal Cell Marker) Antibody

Sign In for Pricing
View Details
SLC13A3 Rabbit Polyclonal Antibody (FITC)
orb3128824 100 µg

SLC13A3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MREG Antibody, FITC conjugated
CSB-PA014788LC01HU-01 50 µg

MREG Antibody, FITC conjugated

Sign In for Pricing
View Details
MREG Antibody, FITC conjugated
CSB-PA014788LC01HU-02 100 µg

MREG Antibody, FITC conjugated

Sign In for Pricing
View Details
GABRQ Rabbit Polyclonal Antibody (BF488)
orb2538012 100 µL

GABRQ Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Phospho-c-Fos (Ser32) Polyclonal Antibody, Cy3 Conjugated
bs-3152R-Cy3-TR 20 µL

Phospho-c-Fos (Ser32) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details