Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect CECD protein

This Insect CECD protein spans the amino acid sequence from region 25-60aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CECDCecropin-D

UniProt

O76146

Expression Region

25-60aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Bombyx mori (Silk moth)

Field of Research

Epigenetics, Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PPAR alpha Rabbit pAb
GB11163-50 50 μL

Anti-PPAR alpha Rabbit pAb

Sign In for Pricing
View Details
Monkey Malonyl-CoA Decarboxylase, Mitochondrial ELISA Kit
MBS052070-01 48 Well

Monkey Malonyl-CoA Decarboxylase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Monkey Malonyl-CoA Decarboxylase, Mitochondrial ELISA Kit
MBS052070-02 96 Well

Monkey Malonyl-CoA Decarboxylase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Monkey Malonyl-CoA Decarboxylase, Mitochondrial ELISA Kit
MBS052070-03 5x 96 Well

Monkey Malonyl-CoA Decarboxylase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Monkey Malonyl-CoA Decarboxylase, Mitochondrial ELISA Kit
MBS052070-04 10x 96 Well

Monkey Malonyl-CoA Decarboxylase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Methyclothiazide
164889 100 mg

Methyclothiazide

Sign In for Pricing
View Details