Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect CECD protein

This Insect CECD protein spans the amino acid sequence from region 25-60aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CECDCecropin-D

UniProt

O76146

Expression Region

25-60aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Bombyx mori (Silk moth)

Field of Research

Epigenetics, Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microtubule Associated Protein 9 (MAP9) Antibody
abx405685-01 100 µL

Microtubule Associated Protein 9 (MAP9) Antibody

Sign In for Pricing
View Details
Microtubule Associated Protein 9 (MAP9) Antibody
abx405685-02 200 µL

Microtubule Associated Protein 9 (MAP9) Antibody

Sign In for Pricing
View Details
Microtubule Associated Protein 9 (MAP9) Antibody
abx405685-03 1 mL

Microtubule Associated Protein 9 (MAP9) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ppa1 shRNA (UAS) - Lentiviral mouse Ppa1 shRNA (UAS, RFP) plasmid
GTR15230941 1 Vial

Lentiviral mouse Ppa1 shRNA (UAS) - Lentiviral mouse Ppa1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CCDC97 Protein Vector (Mouse) (pPM-C-His)
PV162689 500 ng

CCDC97 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
2-Amino-2- (4-methanesulfonylphenyl) propanoic acid
JVB69374-01 100 mg

2-Amino-2- (4-methanesulfonylphenyl) propanoic acid

Sign In for Pricing
View Details