Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect CECD protein

This Insect CECD protein spans the amino acid sequence from region 25-60aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CECDCecropin-D

UniProt

O76146

Expression Region

25-60aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Bombyx mori (Silk moth)

Field of Research

Epigenetics, Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Calreticulin Antibody (6Q988)
TMAB-00272-01 50 μL

Anti-Calreticulin Antibody (6Q988)

Sign In for Pricing
View Details
Anti-Calreticulin Antibody (6Q988)
TMAB-00272-02 100 µL

Anti-Calreticulin Antibody (6Q988)

Sign In for Pricing
View Details
Rat Pdxp Pre-designed siRNA Set A
SI210275A 1 Each

Rat Pdxp Pre-designed siRNA Set A

Sign In for Pricing
View Details
SEC24B Rabbit Polyclonal Antibody (BF680)
orb2417222 100 µL

SEC24B Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Lentiviral human IFI27L2 sgRNA gene knockout kit - Lentiviral human IFI27L2 sgRNA gene knockout kit (100)
GTR15377440 1 Vial

Lentiviral human IFI27L2 sgRNA gene knockout kit - Lentiviral human IFI27L2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TEC, NT (TEC, PSCTK4, Tyrosine-protein kinase Tec)
MBS646706-01 0.2 mL

TEC, NT (TEC, PSCTK4, Tyrosine-protein kinase Tec)

Sign In for Pricing
View Details