Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hamster NEU2 protein

This Hamster NEU2 protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytosolic sialidase (N-acetyl-alpha-neuraminidase 2)

UniProt

Q64393

Expression Region

1-379aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tick-borne Encephalitis Virus Protein
OPMA04672-1MG 1 mg

Tick-borne Encephalitis Virus Protein

Sign In for Pricing
View Details
Rat Hyaluronate binding protein ELISA kit
GTR10440648 96 Well

Rat Hyaluronate binding protein ELISA kit

Sign In for Pricing
View Details
IL-13 CRISPR Activation Plasmid (m2)
sc-421086-ACT-2 20 µg

IL-13 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
2,2-difluoro-1- (3-methyl-5-propoxyphenyl) ethanone
PC1020034-01 250 mg

2,2-difluoro-1- (3-methyl-5-propoxyphenyl) ethanone

Sign In for Pricing
View Details
2,2-difluoro-1- (3-methyl-5-propoxyphenyl) ethanone
PC1020034-02 500 mg

2,2-difluoro-1- (3-methyl-5-propoxyphenyl) ethanone

Sign In for Pricing
View Details
2,2-difluoro-1- (3-methyl-5-propoxyphenyl) ethanone
PC1020034-03 1 g

2,2-difluoro-1- (3-methyl-5-propoxyphenyl) ethanone

Sign In for Pricing
View Details