Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate EPO protein

This Primate EPO protein spans the amino acid sequence from region 28-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPOErythropoietin

UniProt

P07865

Expression Region

28-192aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ11184 CRISPR/Cas9 KO Plasmid (h)
sc-412516 20 µg

FLJ11184 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Rat Fatty Acid Synthase (FASN) Protein
abx066534-01 10 µg

Rat Fatty Acid Synthase (FASN) Protein

Sign In for Pricing
View Details
Rat Fatty Acid Synthase (FASN) Protein
abx066534-02 50 µg

Rat Fatty Acid Synthase (FASN) Protein

Sign In for Pricing
View Details
Rat Fatty Acid Synthase (FASN) Protein
abx066534-03 100 µg

Rat Fatty Acid Synthase (FASN) Protein

Sign In for Pricing
View Details
Rat Fatty Acid Synthase (FASN) Protein
abx066534-04 200 µg

Rat Fatty Acid Synthase (FASN) Protein

Sign In for Pricing
View Details
Rat Fatty Acid Synthase (FASN) Protein
abx066534-05 500 µg

Rat Fatty Acid Synthase (FASN) Protein

Sign In for Pricing
View Details