Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD22 protein

This Human CD22 protein spans the amino acid sequence from region 20-687aa. Purity: Greater than 94% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-lymphocyte cell adhesion molecule (BL-CAM) (Sialic acid-binding Ig-like lectin 2) (Siglec-2) (T-cell surface antigen Leu-14) (CD22)

UniProt

P20273

Expression Region

20-687aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 94% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 μg/ml can bind Anti-CD22 rabbit monoclonal antibody, the EC50 of human CD22 protein is 4.034-4.800 ng/ml.

Form

Lyophilized powder

Molecular Weight

77.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Glycoprotein 2 of Andes Virus IgG fraction (Monoclonal). Clone 1B5/E9
HNM-6023AZ1-5 100 µg

Anti-Glycoprotein 2 of Andes Virus IgG fraction (Monoclonal). Clone 1B5/E9

Sign In for Pricing
View Details
Canine Galectin-1 (LGALS1) ELISA Kit
GTR10341879 96 Well

Canine Galectin-1 (LGALS1) ELISA Kit

Sign In for Pricing
View Details
FBLN5 Antibody, FITC conjugated
CSB-PA866209NC01HU-01 50 μL

FBLN5 Antibody, FITC conjugated

Sign In for Pricing
View Details
FBLN5 Antibody, FITC conjugated
CSB-PA866209NC01HU-02 100 µL

FBLN5 Antibody, FITC conjugated

Sign In for Pricing
View Details
UBE2D2 Antibody
orb653147 100 µL

UBE2D2 Antibody

Sign In for Pricing
View Details
RAD17 (NM_001278622) Human Untagged Clone
SC337168 10 µg

RAD17 (NM_001278622) Human Untagged Clone

Sign In for Pricing
View Details