Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Srpx2 protein

This Mouse Srpx2 protein spans the amino acid sequence from region 26-468aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Srpx2Sushi repeat-containing protein SRPX2

UniProt

Q8R054

Expression Region

26-468aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin Like Growth Factor 1 (IGF1) Recombinant, Mouse
155179-01 10 µg

Insulin Like Growth Factor 1 (IGF1) Recombinant, Mouse

Sign In for Pricing
View Details
Insulin Like Growth Factor 1 (IGF1) Recombinant, Mouse
155179-02 50 µg

Insulin Like Growth Factor 1 (IGF1) Recombinant, Mouse

Sign In for Pricing
View Details
Insulin Like Growth Factor 1 (IGF1) Recombinant, Mouse
155179-03 200 µg

Insulin Like Growth Factor 1 (IGF1) Recombinant, Mouse

Sign In for Pricing
View Details
Pms2 Mouse shRNA Plasmid (Locus ID 18861)
TL513881 1 Kit

Pms2 Mouse shRNA Plasmid (Locus ID 18861)

Sign In for Pricing
View Details
NP2 shRNA Plasmid (m)
sc-42096-SH 20 µg

NP2 shRNA Plasmid (m)

Sign In for Pricing
View Details
Alpha-1-Antitrypsin (353-394) Variant / CAAP47 (Human)
066-75 100 µg

Alpha-1-Antitrypsin (353-394) Variant / CAAP47 (Human)

Sign In for Pricing
View Details