Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lgi3 protein

This Mouse Lgi3 protein spans the amino acid sequence from region 31-548aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leubrin (Leucine-rich glioma-inactivated protein 3)

UniProt

Q8K406

Expression Region

31-548aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KRPPKTPPCPPSCSCTRDTAFCVDSKSVPKNLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDGQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWFFAVADSSKAGATSLYRWHQNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRSQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGHRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il21 Mouse Recombinant Protein
TP727316 10 µg

Il21 Mouse Recombinant Protein

Sign In for Pricing
View Details
Ccdc17-set siRNA/shRNA/RNAi Lentivector (Rat)
15237096 4x 500 ng

Ccdc17-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
LEF1 (Lymphoid Enhancer-binding Factor 1)
484708 100 µL

LEF1 (Lymphoid Enhancer-binding Factor 1)

Sign In for Pricing
View Details
KISS1R Rabbit pAb
A2967-01 20 µL

KISS1R Rabbit pAb

Sign In for Pricing
View Details
KISS1R Rabbit pAb
A2967-02 100 μL

KISS1R Rabbit pAb

Sign In for Pricing
View Details
KISS1R Rabbit pAb
A2967-03 500 μL

KISS1R Rabbit pAb

Sign In for Pricing
View Details