Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lgi3 protein

This Mouse Lgi3 protein spans the amino acid sequence from region 31-548aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leubrin (Leucine-rich glioma-inactivated protein 3)

UniProt

Q8K406

Expression Region

31-548aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KRPPKTPPCPPSCSCTRDTAFCVDSKSVPKNLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDGQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWFFAVADSSKAGATSLYRWHQNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRSQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGHRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABI2 Human Pre-designed siRNA Set A
HY-RS00099 1 Set

ABI2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-GSTO1
Y123251 100 µL

Anti-GSTO1

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Elongation factor G (fusA), partial
MBS1258292 Inquire

Recombinant Synechococcus sp. Elongation factor G (fusA), partial

Sign In for Pricing
View Details
Olr1305 CRISPRa sgRNA lentivector (set of three targets)(Rat)
33824126 3x 1.0µg DNA

Olr1305 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rabbit Monoclonal PD-1 Antibody (PDCD1/7255R) [Alexa Fluor 532]
NBP3-20956AF532 0.1 mL

Rabbit Monoclonal PD-1 Antibody (PDCD1/7255R) [Alexa Fluor 532]

Sign In for Pricing
View Details
CAMK2B Protein Lysate (Rat) with C-HA Tag
14958037 100 µg

CAMK2B Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details