Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY96 protein

This Human LY96 protein spans the amino acid sequence from region 19-160aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ESOP-1 (Protein MD-2) (Ly-96) (ESOP1) (MD2)

UniProt

Q9Y6Y9

Expression Region

19-160aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf71 Protein Vector (Human) (pPM-C-HA)
PV065531 500 ng

C12orf71 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Complement C5 beta chain Polyclonal Antibody
TMAB-04546-01 50 μL

Anti-Complement C5 beta chain Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Complement C5 beta chain Polyclonal Antibody
TMAB-04546-02 100 µL

Anti-Complement C5 beta chain Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Complement C5 beta chain Polyclonal Antibody
TMAB-04546-03 200 µL

Anti-Complement C5 beta chain Polyclonal Antibody

Sign In for Pricing
View Details
PPP2R1B Conjugated Antibody
orb1617206 100 µL

PPP2R1B Conjugated Antibody

Sign In for Pricing
View Details
AGER Antibody Pair
MBS7042001-01 1 Pair (Sufficient for 5x 96 Well Plates)

AGER Antibody Pair

Sign In for Pricing
View Details