Human LY96 protein
This Human LY96 protein spans the amino acid sequence from region 19-160aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ESOP-1 (Protein MD-2) (Ly-96) (ESOP1) (MD2)
UniProt
Q9Y6Y9
Expression Region
19-160aa
Tag
N-terminal 10xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7248043-01 48 Well
Rabbit Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit
Sign In for Pricing
View Details MBS7248043-02 96 Well
Rabbit Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit
Sign In for Pricing
View Details MBS7248043-03 5x 96 Well
Rabbit Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit
Sign In for Pricing
View Details MBS7248043-04 10x 96 Well
Rabbit Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) ELISA Kit
Sign In for Pricing
View Details 
125182-ML650 100 µL
COL24A1 (MGC142214, Collagen alpha-1 (XXIV) Chain) (MaxLight 650)
Sign In for Pricing
View Details MBS6352022-01 0.1 mL
Stk24, ID (Stk24, Mst3, Stk3, Serine/threonine-protein kinase 24, Mammalian STE20-like protein kinase 3, STE20-like kinase MST3, Serine/threonine-protein kinase 24 35kD subunit, Mammalian STE20-like protein kinase 3 N-terminal, Serine/threonine-protein ki
Sign In for Pricing
View Details