Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY96 protein

This Human LY96 protein spans the amino acid sequence from region 19-160aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ESOP-1 (Protein MD-2) (Ly-96) (ESOP1) (MD2)

UniProt

Q9Y6Y9

Expression Region

19-160aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PNPLA4 shRNA (UAS) - Lentiviral human PNPLA4 shRNA (UAS, RFP) (100)
GTR15287136 1 Vial

Lentiviral human PNPLA4 shRNA (UAS) - Lentiviral human PNPLA4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human Ub ELISA Kit (Ready to Use)
orb552724-01 48 Tests

Human Ub ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human Ub ELISA Kit (Ready to Use)
orb552724-02 96 Tests

Human Ub ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Lentiviral human ZBTB48 shRNA (UAS) - Lentiviral human ZBTB48 shRNA (UAS, GFP) (25)
GTR15164192 1 Vial

Lentiviral human ZBTB48 shRNA (UAS) - Lentiviral human ZBTB48 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TCTN3 (Tectonic-3, C10orf61, TECT3, PSEC0041, UNQ1881/PRO4324, DKFZp564D116)
146691 100 µg

TCTN3 (Tectonic-3, C10orf61, TECT3, PSEC0041, UNQ1881/PRO4324, DKFZp564D116)

Sign In for Pricing
View Details
Setipiprant (ACT-129968)
C11316 25 mg

Setipiprant (ACT-129968)

Sign In for Pricing
View Details