Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CYP2C19 protein

This Human CYP2C19 protein spans the amino acid sequence from region 26-490aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(R) -limonene 6-monooxygenase ((S) -limonene 6-monooxygenase) ((S) -limonene 7-monooxygenase) (CYPIIC17) (CYPIIC19) (Cytochrome P450-11A) (Cytochrome P450-254C) (Fenbendazole monooxygenase) (Mephenytoin 4-hydroxylase)

UniProt

P33261

Expression Region

26-490aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORD4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV721607 1.0 µg DNA

CORD4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CSRP2 (Cysteine and Glycine-rich Protein 2)
478683 100 µL

CSRP2 (Cysteine and Glycine-rich Protein 2)

Sign In for Pricing
View Details
Human PDGFC qPCR Primer Pair
QH08829S 200 Tests

Human PDGFC qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Smyd5 qPCR Primer Pair
QM60014S 200 Tests

Mouse Smyd5 qPCR Primer Pair

Sign In for Pricing
View Details
RIP140 (NRIP1) (NM_003489) Human Over-expression Lysate
E45H06706-2 20 µg

RIP140 (NRIP1) (NM_003489) Human Over-expression Lysate

Sign In for Pricing
View Details
Human E3 Ubiquitin-Protein Ligase CBL-C / CBL-3 (CBLC) Protein
abx693482 100 µg

Human E3 Ubiquitin-Protein Ligase CBL-C / CBL-3 (CBLC) Protein

Sign In for Pricing
View Details