Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HAPLN4 protein

This Human HAPLN4 protein spans the amino acid sequence from region 30-402aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain link protein 2 (BRAL2) (KIAA1926)

UniProt

Q86UW8

Expression Region

30-402aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody
MBS438570-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody
MBS438570-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody
MBS438570-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody
MBS438570-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody
MBS438570-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Herpes Simplex Virus II, Glycoprotein E (HSV II) (FITC)
MBS632966-01 1 mL

Herpes Simplex Virus II, Glycoprotein E (HSV II) (FITC)

Sign In for Pricing
View Details