Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant epo protein

This Plant epo protein spans the amino acid sequence from region 24-183aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Erythropoietin-L2

UniProt

Q2XNF5

Expression Region

24-183aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF12 Rabbit Polyclonal Antibody
TA370900 100 µL

KLF12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXI2 Human Gene Knockout Kit (CRISPR)
KN416961 1 Kit

FOXI2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BPGM Polyclonal Antibody
E-AB-68413-01 60 µL

BPGM Polyclonal Antibody

Sign In for Pricing
View Details
BPGM Polyclonal Antibody
E-AB-68413-02 120 µL

BPGM Polyclonal Antibody

Sign In for Pricing
View Details
BPGM Polyclonal Antibody
E-AB-68413-03 200 µL

BPGM Polyclonal Antibody

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), 0.2mg/mL
BNUB1757-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), 0.2mg/mL

Sign In for Pricing
View Details