Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus X protein

This Virus X protein spans the amino acid sequence from region 1-141aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBx (Peptide X) (pX)

UniProt

P17401

Expression Region

1-141aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Woodchuck hepatitis B virus (isolate 8) (WHV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMH Antibody
CSB-PA001666GA01HU 100 µL

AMH Antibody

Sign In for Pricing
View Details
PSMA7 Polyclonal Antibody
orb1416404 100 µL

PSMA7 Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
MBS2104864-01 24 Strip Well

Sheep Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details
Sheep Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
MBS2104864-02 48 Strip Well

Sheep Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details
Sheep Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
MBS2104864-03 96 Strip Well

Sheep Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details
Sheep Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
MBS2104864-04 5x 96 Strip Well

Sheep Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details