Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIG7 protein

This Human MIG7 protein spans the amino acid sequence from region 1-207aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q1AHR6

Expression Region

1-207aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAASRCSGLSEMTLLGSQAVSGLSSPLKSPCQVWNSPSPVCVCVCVCVCVCTRVHMRACSAGSAYLKQMKFCRMAASLDKVKKTDRGERGSCVSTTKRQASLSQRDIPSNNMKLATFPSDVNVESVAASLFFTVMKLGATQLEWNTKTPLGNTSSGFESQLYHSPAIDSEQDLSEVISSQSVETRLTSKVLKVEPESMNAKVFTFKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SNED1 Knockout HEK293T cell line
GTR15414283 1 Vial

Human SNED1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Porcine 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit
MBS7214716-01 48 Well

Porcine 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit

Sign In for Pricing
View Details
Porcine 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit
MBS7214716-02 96 Well

Porcine 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit

Sign In for Pricing
View Details
Porcine 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit
MBS7214716-03 5x 96 Well

Porcine 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit

Sign In for Pricing
View Details
Porcine 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit
MBS7214716-04 10x 96 Well

Porcine 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit

Sign In for Pricing
View Details
Daphniyunnine A
380023 5 mg

Daphniyunnine A

Sign In for Pricing
View Details