Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PAX8 protein

This Human PAX8 protein spans the amino acid sequence from region 1-450aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTTHUMP00000158659, OTTHUMP00000158660, OTTHUMP00000203723, OTTHUMP00000203724, Paired box 8, Paired box gene 8, paired box homeotic gene 8, Paired box protein Pax 8, Paired box protein Pax-8, Paired domain gene 8, PAX 8, PAX8, PAX8_HUMAN

UniProt

Q06710

Expression Region

1-450aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS707478 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
1,16-Hexadecanedioic-d28 Acid
TRC-H293634-1MG 1 mg

1,16-Hexadecanedioic-d28 Acid

Sign In for Pricing
View Details
Human SLC25A46 activation kit by CRISPRa
GA114089 1 Kit

Human SLC25A46 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS623041 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
TIMM50 Rabbit Monoclonal Antibody [Clone ID: 24GB5300]
TA425341 100 µL

TIMM50 Rabbit Monoclonal Antibody [Clone ID: 24GB5300]

Sign In for Pricing
View Details
Brilliant Thallium Gold Pioneer
11020-2 2 Plates

Brilliant Thallium Gold Pioneer

Sign In for Pricing
View Details