Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine alpha Synuclein protein

This Porcine alpha Synuclein protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNCA, Alpha-synuclein

UniProt

Q3I5G7

Expression Region

1-140aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (Breast Marker) (BRCA1/1472), CF640R conjugate, 0.1mg/mL
BNC401472-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1472), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FHL2 Rabbit Polyclonal Antibody
AP05258SU-N 100 µg

FHL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fluoronitrofen
TRC-F156430-250MG 250 mg

Fluoronitrofen

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF647 conjugate, 0.1mg/mL
BNC472037-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DEFB124 (NM_001037500) Human Recombinant Protein
TP317724L 1 mg

DEFB124 (NM_001037500) Human Recombinant Protein

Sign In for Pricing
View Details
FAM110A (NM_031424) Human Recombinant Protein
TP761331 50 µg

FAM110A (NM_031424) Human Recombinant Protein

Sign In for Pricing
View Details