Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine alpha Synuclein protein

This Porcine alpha Synuclein protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNCA, Alpha-synuclein

UniProt

Q3I5G7

Expression Region

1-140aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ThrombomoduLin (THBD) (NM_000361) Human Recombinant Protein
TP701227 50 µg

ThrombomoduLin (THBD) (NM_000361) Human Recombinant Protein

Sign In for Pricing
View Details
Cell Navigator® F-Actin Labeling Kit *Blue Fluorescence*
22660-AAT 500 Tests

Cell Navigator® F-Actin Labeling Kit *Blue Fluorescence*

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-27 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
Tissue FFPE Sections, Jejunum
CS709045 5x 5 µm

Tissue FFPE Sections, Jejunum

Sign In for Pricing
View Details
Mouse Thrombomodulin (TM) ELISA Kit
RDR-TM-Mu-01 96 Tests

Mouse Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details
Mouse Thrombomodulin (TM) ELISA Kit
RDR-TM-Mu-02 48 Tests

Mouse Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details