Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine alpha Synuclein protein

This Porcine alpha Synuclein protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNCA, Alpha-synuclein

UniProt

Q3I5G7

Expression Region

1-140aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adiponectin (Marker of Obesity) (ADPN/1370), CF640R conjugate, 0.1mg/mL
BNC401370-100 1x 100 µL

Adiponectin (Marker of Obesity) (ADPN/1370), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Mouse CD22 (Cy34.1) In Vivo Antibody - Low Endotoxin
ICH1181-100mg 100 mg

Anti-Mouse CD22 (Cy34.1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
HRP Conjugated HIV1 p24 Mouse Monoclonal Antibody [12G2]
HA601160 100 µL

HRP Conjugated HIV1 p24 Mouse Monoclonal Antibody [12G2]

Sign In for Pricing
View Details
HRH1 (NM_001098211) Human Over-expression Lysate
LY426007 100 µg

HRH1 (NM_001098211) Human Over-expression Lysate

Sign In for Pricing
View Details
ErbB 4 (ERBB4) (NM_001042599) Human Recombinant Protein
TP710093 20 µg

ErbB 4 (ERBB4) (NM_001042599) Human Recombinant Protein

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), Biotin conjugate, 0.1mg/mL
BNCB0280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details