Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus VP40 protein

This Virus VP40 protein spans the amino acid sequence from region 1-326aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Membrane-associated protein VP40

UniProt

Q77DJ6

Expression Region

1-326aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTTP (100 mM) ≥99% HPLC
C01580-250 250 mL (250.0 mL/Bottle)

DTTP (100 mM) ≥99% HPLC

Sign In for Pricing
View Details
Canine Selectin, Endothelium (SELE) Antibody Pair Kit (with Standard)
MBS2098241-01 5x 96 Tests

Canine Selectin, Endothelium (SELE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Canine Selectin, Endothelium (SELE) Antibody Pair Kit (with Standard)
MBS2098241-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Canine Selectin, Endothelium (SELE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Canine Selectin, Endothelium (SELE) Antibody Pair Kit (with Standard)
MBS2098241-03 10x 96 Tests

Canine Selectin, Endothelium (SELE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Canine Selectin, Endothelium (SELE) Antibody Pair Kit (with Standard)
MBS2098241-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Canine Selectin, Endothelium (SELE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
TLR5, Control Peptide (Toll Like Receptor 5, Toll/Interluekin-1 Receptor-Like Gene 3, TIL3, CD285)
T8050-43A 50 µg

TLR5, Control Peptide (Toll Like Receptor 5, Toll/Interluekin-1 Receptor-Like Gene 3, TIL3, CD285)

Sign In for Pricing
View Details