Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant XERO1 protein

This Plant XERO1 protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DHNX

UniProt

P25863

Expression Region

1-128aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSMD1 activation kit by CRISPRa
GA112085 1 Kit

Human CSMD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Chromogranin A (PHE5), Biotin conjugate, 0.1mg/mL
BNCB0461-500 1x 500 µL

Chromogranin A (PHE5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pilsicainide Hydrochloride
TRC-P441508-50MG 50 mg

Pilsicainide Hydrochloride

Sign In for Pricing
View Details
Eif5a (NM_181582) Mouse Tagged ORF Clone
MG201137 10 µg

Eif5a (NM_181582) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
XRCC3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C1]
TA804776AM 100 µL

XRCC3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C1]

Sign In for Pricing
View Details
DDX55 (NM_020936) Human Recombinant Protein
TP306085M 100 µg

DDX55 (NM_020936) Human Recombinant Protein

Sign In for Pricing
View Details