Plant XERO1 protein
This Plant XERO1 protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
DHNX
UniProt
P25863
Expression Region
1-128aa
Tag
N-terminal 6xHis-sumostar-tagged
Source
Yeast
Origin
Arabidopsis thaliana (Mouse-ear cress)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
26.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® Red 780 Anti-Human CD38 Antibody[HIT2]](https://cdn.genprice.uk/products/763/68dd14a5061270361e7d17bf/imageurl/e-ab-f1058s.webp)
E-AB-F1058S-01 20 Tests
Elab Fluor® Red 780 Anti-Human CD38 Antibody[HIT2]
Sign In for Pricing
View Details E-AB-F1058S-02 100 Tests
Elab Fluor® Red 780 Anti-Human CD38 Antibody[HIT2]
Sign In for Pricing
View Details E-AB-F1058S-03 2x 100 Tests
Elab Fluor® Red 780 Anti-Human CD38 Antibody[HIT2]
Sign In for Pricing
View Details 
BNC400370-500 1x 500 µL
CD117 (C117/370), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682397-500 1x 500 µL
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683529-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details