Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse MIF protein

This Mouse MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Delayed early response protein 6 (DER6) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC, 5.3.3.12) ) (Phenylpyruvate tautomerase) (MIF)

UniProt

P34884

Expression Region

2-115aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEX13A Antibody, Biotin conjugated
A70061-100UG 100 µg

TEX13A Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-GKAP1 Antibody Picoband®, PE Conjugate
A14397-1-PE 100 µg/Vial

Anti-GKAP1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
SRRM3 Antibody - N-terminal region : HRP (ARP71679_P050-HRP)
ARP71679_P050-HRP 100 µL

SRRM3 Antibody - N-terminal region : HRP (ARP71679_P050-HRP)

Sign In for Pricing
View Details
PKLR Peptide - N-terminal region
orb2002835 100 µg

PKLR Peptide - N-terminal region

Sign In for Pricing
View Details
INSM2 (Insulinoma-Associated Protein 2, Zinc Finger Protein IA-6, INSM2, IA6) (APC) discontinued
302503-APC 200 µL

INSM2 (Insulinoma-Associated Protein 2, Zinc Finger Protein IA-6, INSM2, IA6) (APC) discontinued

Sign In for Pricing
View Details
Lysmd1 3'UTR Luciferase Stable Cell Line
TU112753 1.0 mL

Lysmd1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details