Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse MIF protein

This Mouse MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Delayed early response protein 6 (DER6) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC, 5.3.3.12) ) (Phenylpyruvate tautomerase) (MIF)

UniProt

P34884

Expression Region

2-115aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Trim22 Antibody (OTI1D11) [Dylight 594]
NBP2-74608DL594 0.1 mL

Mouse Monoclonal Trim22 Antibody (OTI1D11) [Dylight 594]

Sign In for Pricing
View Details
AMCase (CHIA) Rabbit Polyclonal Antibody
TA329463 100 µL

AMCase (CHIA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPGR Lentiviral Activation Particles (h2)
sc-404441-LAC-2 200 µL

RPGR Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
TBLR1 (TBL1XR1) Rabbit Polyclonal Antibody
TA358001 100 µL

TBLR1 (TBL1XR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Hydroxyacylglutathione hydrolase, Mitochondrial ELISA kit
GTR10466022 96 Well

Rat Hydroxyacylglutathione hydrolase, Mitochondrial ELISA kit

Sign In for Pricing
View Details
Phospho-NCOA3 (Thr24) Rabbit Polyclonal Antibody (Cy7)
orb1047432 100 µL

Phospho-NCOA3 (Thr24) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details