Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant XERO1 protein

This Plant XERO1 protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DHNX

UniProt

P25863

Expression Region

1-128aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Platelet Derived Growth Factor Receptor Alpha (PDGFRA) Antibody
abx326810-01 50 µg

Platelet Derived Growth Factor Receptor Alpha (PDGFRA) Antibody

Sign In for Pricing
View Details
Platelet Derived Growth Factor Receptor Alpha (PDGFRA) Antibody
abx326810-02 100 µg

Platelet Derived Growth Factor Receptor Alpha (PDGFRA) Antibody

Sign In for Pricing
View Details
4,4,5,5-Tetramethyl-2- (1-phenylethyl) -1,3,2-dioxaborolane
OR1064885-01 100 mg

4,4,5,5-Tetramethyl-2- (1-phenylethyl) -1,3,2-dioxaborolane

Sign In for Pricing
View Details
4,4,5,5-Tetramethyl-2- (1-phenylethyl) -1,3,2-dioxaborolane
OR1064885-02 250 mg

4,4,5,5-Tetramethyl-2- (1-phenylethyl) -1,3,2-dioxaborolane

Sign In for Pricing
View Details
4,4,5,5-Tetramethyl-2- (1-phenylethyl) -1,3,2-dioxaborolane
OR1064885-03 1 g

4,4,5,5-Tetramethyl-2- (1-phenylethyl) -1,3,2-dioxaborolane

Sign In for Pricing
View Details
MKI67 Knockout CAL27 Polyclonal Cells
ARG11546 1 Million

MKI67 Knockout CAL27 Polyclonal Cells

Sign In for Pricing
View Details