Mouse Dbi protein
This Mouse Dbi protein spans the amino acid sequence from region 2-87aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Diazepam-binding inhibitor (DBI) (Endozepine) (EP) (ACBP)
UniProt
P31786
Expression Region
2-87aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1132383-01 0.5 mg (E-Coli)
Recombinant Pseudomonas putida Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1132383-02 0.05 mg (Baculovirus)
Recombinant Pseudomonas putida Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1132383-03 0.5 mg (Yeast)
Recombinant Pseudomonas putida Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1132383-04 0.05 mg (Mammalian-Cell)
Recombinant Pseudomonas putida Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1132383-05 1 mg (E-Coli)
Recombinant Pseudomonas putida Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1132383-06 0.1 mg (Baculovirus)
Recombinant Pseudomonas putida Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details