Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompX protein

This E. coli ompX protein spans the amino acid sequence from region 24-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OmpX, Z1036, ECs0892, Outer membrane protein X

UniProt

P0A919

Expression Region

24-171aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX3 Rabbit Polyclonal Antibody (HRP)
orb2096879 100 µL

ACOX3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Transfer pipet, 5.8mL, 157mm
134060-500 500/Box

Transfer pipet, 5.8mL, 157mm

Sign In for Pricing
View Details
PRKAA1 Peptide - middle region
orb2013493 100 µg

PRKAA1 Peptide - middle region

Sign In for Pricing
View Details
Anti-c-MET Antibody, Rabbit Polyclonal
MBS8112528-01 0.1 mL

Anti-c-MET Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-c-MET Antibody, Rabbit Polyclonal
MBS8112528-02 5x 0.1 mL

Anti-c-MET Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
2- (Methylamino) ethyl methanethiosulfonate hydrobromide
282671-01 10 mg

2- (Methylamino) ethyl methanethiosulfonate hydrobromide

Sign In for Pricing
View Details