Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus M protein

This Virus M protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M, Matrix protein

UniProt

Q6WB99

Expression Region

1-254aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human metapneumovirus (strain CAN97-83) (HMPV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CLDN6 Antibody (SAA1412), PerCP
MBS1584376-01 50 Tests

Anti-Human CLDN6 Antibody (SAA1412), PerCP

Sign In for Pricing
View Details
Anti-Human CLDN6 Antibody (SAA1412), PerCP
MBS1584376-02 100 Tests

Anti-Human CLDN6 Antibody (SAA1412), PerCP

Sign In for Pricing
View Details
Anti-Human CLDN6 Antibody (SAA1412), PerCP
MBS1584376-03 5x 100 Tests

Anti-Human CLDN6 Antibody (SAA1412), PerCP

Sign In for Pricing
View Details
Lentiviral mouse Supt6 shRNA (UAS) - Lentiviral mouse Supt6 shRNA (UAS) (100)
GTR15219546 1 Vial

Lentiviral mouse Supt6 shRNA (UAS) - Lentiviral mouse Supt6 shRNA (UAS) (100)

Sign In for Pricing
View Details
PSIN-EF2-PUS7-6xHis-Puro Plasmid
PVT80724 2 µg

PSIN-EF2-PUS7-6xHis-Puro Plasmid

Sign In for Pricing
View Details
CENPL rabbit pAb Antibody
orb773399-01 50 μL

CENPL rabbit pAb Antibody

Sign In for Pricing
View Details