Virus M protein
This Virus M protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
M, Matrix protein
UniProt
Q6WB99
Expression Region
1-254aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Human metapneumovirus (strain CAN97-83) (HMPV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T0691 1x 10^6 Cells - 1.0 mL
Immortalized Human Nucleus Pulposus Cells - hTERT
Sign In for Pricing
View Details 
MBS6413227-01 0.1 mL
CXCL1 (Chemokine C-X-C-Motif Ligand 1, FSP, GRO1, GROa, MGSA, NAP-3, SCYB1, MGSA-a) (MaxLight 650)
Sign In for Pricing
View Details MBS6413227-02 5x 0.1 mL
CXCL1 (Chemokine C-X-C-Motif Ligand 1, FSP, GRO1, GROa, MGSA, NAP-3, SCYB1, MGSA-a) (MaxLight 650)
Sign In for Pricing
View Details 
GTR15266073 1 Vial
Lentiviral mouse Ube2n shRNA (UAS) - Lentiviral mouse Ube2n shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details 
orb3003596 100 µg
Zebrafish RPL8 Rabbit Polyclonal Antibody (Biotin)
Sign In for Pricing
View Details