Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus M protein

This Virus M protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M, Matrix protein

UniProt

Q6WB99

Expression Region

1-254aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human metapneumovirus (strain CAN97-83) (HMPV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK5RAP3 Antibody
orb671060-01 50 µg

CDK5RAP3 Antibody

Sign In for Pricing
View Details
CDK5RAP3 Antibody
orb671060-02 100 µg

CDK5RAP3 Antibody

Sign In for Pricing
View Details
Lentiviral human GRID2IP sgRNA gene knockout kit - Lentiviral human GRID2IP sgRNA gene knockout kit (100)
GTR15361708 1 Vial

Lentiviral human GRID2IP sgRNA gene knockout kit - Lentiviral human GRID2IP sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Protein jagunal homolog (K05C4.2)
orb2919118-01 20 µg

Recombinant Protein jagunal homolog (K05C4.2)

Sign In for Pricing
View Details
Recombinant Protein jagunal homolog (K05C4.2)
orb2919118-02 100 µg

Recombinant Protein jagunal homolog (K05C4.2)

Sign In for Pricing
View Details
Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
TRV-0003371-01 20 µL

Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details