What is the catalog number for Rat Mcpt1 protein?

The catalog number for Rat Mcpt1 protein is orb604732.

What sizes are available for Rat Mcpt1 protein?

Rat Mcpt1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Rat Mcpt1 protein come in?

Rat Mcpt1 protein is available in 3 different pack sizes.

Is Rat Mcpt1 protein in stock?

Rat Mcpt1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Rat Mcpt1 protein

This Rat Mcpt1 protein spans the amino acid sequence from region 21-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chymase (Chymotrypsin-like protease) (CLIP protein) (Mast cell protease I) (rMCP-I) (rMCP-1)

UniProt

P09650

Expression Region

21-260aa

Tag

N-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS