Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mcpt1 protein

This Rat Mcpt1 protein spans the amino acid sequence from region 21-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chymase (Chymotrypsin-like protease) (CLIP protein) (Mast cell protease I) (rMCP-I) (rMCP-1)

UniProt

P09650

Expression Region

21-260aa

Tag

N-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB7, ID (ASB7, Ankyrin repeat and SOCS box protein 7) (Biotin)
MBS6275569-01 0.2 mL

ASB7, ID (ASB7, Ankyrin repeat and SOCS box protein 7) (Biotin)

Sign In for Pricing
View Details
ASB7, ID (ASB7, Ankyrin repeat and SOCS box protein 7) (Biotin)
MBS6275569-02 5x 0.2 mL

ASB7, ID (ASB7, Ankyrin repeat and SOCS box protein 7) (Biotin)

Sign In for Pricing
View Details
PTEN-induced Kinase 1 (PTEN-induced Putative Kinase 1, PTEN-induced Putative Kinase Protein 1, PINK1, PINK-1, BRPK, FLJ27236, PARK6, Serine/threonine Protein Kinase PINK1 Mitochondrial) discontinued
P9181-90G 100 µg

PTEN-induced Kinase 1 (PTEN-induced Putative Kinase 1, PTEN-induced Putative Kinase Protein 1, PINK1, PINK-1, BRPK, FLJ27236, PARK6, Serine/threonine Protein Kinase PINK1 Mitochondrial) discontinued

Sign In for Pricing
View Details
Interferon gamma (IFN-gamma, IFNg, IFNG2) (PE) discontinued
I7661-68R-PE 100 µL

Interferon gamma (IFN-gamma, IFNg, IFNG2) (PE) discontinued

Sign In for Pricing
View Details
ANPEP Antibody
orb389124-01 20 µg

ANPEP Antibody

Sign In for Pricing
View Details
ANPEP Antibody
orb389124-02 100 µg

ANPEP Antibody

Sign In for Pricing
View Details