Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Bmp8b protein

This Mouse Bmp8b protein spans the amino acid sequence from region 261-399aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BMP-8B

UniProt

P55105

Expression Region

261-399aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TARPLKKKQLNQINQLPHSNKHLGILDDGHGSHGREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPKVCCVPTELSAISLLYYDRNNNVILRRERNMVVQACGCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT1 Polyclonal Conjugated Antibody
MBS9441892-01 0.1 mL (Biotin)

MGAT1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MGAT1 Polyclonal Conjugated Antibody
MBS9441892-02 0.1 mL (AF350)

MGAT1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MGAT1 Polyclonal Conjugated Antibody
MBS9441892-03 0.1 mL (AF405)

MGAT1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MGAT1 Polyclonal Conjugated Antibody
MBS9441892-04 0.1 mL (AF488)

MGAT1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MGAT1 Polyclonal Conjugated Antibody
MBS9441892-05 0.1 mL (AF555)

MGAT1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MGAT1 Polyclonal Conjugated Antibody
MBS9441892-06 0.1 mL (AF594)

MGAT1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details