Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Bmp8b protein

This Mouse Bmp8b protein spans the amino acid sequence from region 261-399aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BMP-8B

UniProt

P55105

Expression Region

261-399aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TARPLKKKQLNQINQLPHSNKHLGILDDGHGSHGREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPKVCCVPTELSAISLLYYDRNNNVILRRERNMVVQACGCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PHF6 (PHD finger protein 6) ELISA Kit
EH4132 96 Tests

Human PHF6 (PHD finger protein 6) ELISA Kit

Sign In for Pricing
View Details
Human HMG20A Knockout A549 cell line
GTR15404050 1 Vial

Human HMG20A Knockout A549 cell line

Sign In for Pricing
View Details
Splicing Factor Proline And Glutamine Rich (SFPQ) Antibody
abx115801 100 µL

Splicing Factor Proline And Glutamine Rich (SFPQ) Antibody

Sign In for Pricing
View Details
PCDHGB6 (NM_032100) Human Tagged ORF Clone Lentiviral Particle
RC221985L3V 200 µL

PCDHGB6 (NM_032100) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLC29A1 Rabbit pAb
E45R19802N-50 50 µL

SLC29A1 Rabbit pAb

Sign In for Pricing
View Details
EBF2 Rabbit Polyclonal Antibody (FITC)
orb2130021 100 µL

EBF2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details