Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria tpd protein

This Bacteria tpd protein spans the amino acid sequence from region 20-204aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pathogen-specific membrane antigen

UniProt

P19478

Expression Region

20-204aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Treponema pallidum (strain Nichols)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ODF2L (NM_020729) Human Over-expression Lysate
LS057489-20ug 20 µg

ODF2L (NM_020729) Human Over-expression Lysate

Sign In for Pricing
View Details
PLSCR4 Antibody
MBS858615-01 0.1 mg

PLSCR4 Antibody

Sign In for Pricing
View Details
PLSCR4 Antibody
MBS858615-02 0.1 mL (AF405L)

PLSCR4 Antibody

Sign In for Pricing
View Details
PLSCR4 Antibody
MBS858615-03 0.1 mL (AF405S)

PLSCR4 Antibody

Sign In for Pricing
View Details
PLSCR4 Antibody
MBS858615-04 0.1 mL (AF610)

PLSCR4 Antibody

Sign In for Pricing
View Details
PLSCR4 Antibody
MBS858615-05 0.1 mL (AF635)

PLSCR4 Antibody

Sign In for Pricing
View Details