Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria tpd protein

This Bacteria tpd protein spans the amino acid sequence from region 20-204aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pathogen-specific membrane antigen

UniProt

P19478

Expression Region

20-204aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Treponema pallidum (strain Nichols)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kallikrein 10, KLK10 ELISA Kit
MBS160929-01 48 Well

Human Kallikrein 10, KLK10 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 10, KLK10 ELISA Kit
MBS160929-02 96 Well

Human Kallikrein 10, KLK10 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 10, KLK10 ELISA Kit
MBS160929-03 5x 96 Well

Human Kallikrein 10, KLK10 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 10, KLK10 ELISA Kit
MBS160929-04 10x 96 Well

Human Kallikrein 10, KLK10 ELISA Kit

Sign In for Pricing
View Details
CYP1A1, CT (Cytochrome P450 1A1, Cytochrome P450-P1, Cytochrome P450 Form 6, Cytochrome P450-C) (PE) discontinued
C9095-16K1-PE 200 µL

CYP1A1, CT (Cytochrome P450 1A1, Cytochrome P450-P1, Cytochrome P450 Form 6, Cytochrome P450-C) (PE) discontinued

Sign In for Pricing
View Details
Morinidazole Impurity 43
RM-M150943-01 10 mg

Morinidazole Impurity 43

Sign In for Pricing
View Details