Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cystatin C protein

This Mouse Cystatin C protein spans the amino acid sequence from region 21-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin-3

UniProt

P21460

Expression Region

21-140aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddx27 (BC011321) Mouse Tagged Lenti ORF Clone
MR208999L4 10 µg

Ddx27 (BC011321) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nanobacteria Removal Complete Medium (10) (MEM)
PM150411B-HR 100 mL

Nanobacteria Removal Complete Medium (10) (MEM)

Sign In for Pricing
View Details
Lentiviral human LCNL1 shRNA (UAS) - Lentiviral human LCNL1 shRNA (UAS, RFP) (25)
GTR15345002 1 Vial

Lentiviral human LCNL1 shRNA (UAS) - Lentiviral human LCNL1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 UPF0181 protein yoaH (yoaH)
MBS1215662-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 UPF0181 protein yoaH (yoaH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 UPF0181 protein yoaH (yoaH)
MBS1215662-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 UPF0181 protein yoaH (yoaH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 UPF0181 protein yoaH (yoaH)
MBS1215662-03 0.02 mg (Yeast)

Recombinant Escherichia coli O17:K52:H18 UPF0181 protein yoaH (yoaH)

Sign In for Pricing
View Details