Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGFL1 protein

This Human IGFL1 protein spans the amino acid sequence from region 25-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGFL1, UNQ644/PRO1274, Insulin growth factor-like family member 1

UniProt

Q6UW32

Expression Region

25-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERI3 Knockout HT29 Polyclonal Cells
ARG14667 1 Million

ERI3 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
ELISA Kit For Zona pellucida sperm-binding protein 3
E11951b 96 Tests

ELISA Kit For Zona pellucida sperm-binding protein 3

Sign In for Pricing
View Details
VEGF Receptor 1 Rabbit Monoclonal Antibody (Detector)
E56PA0714 100 µL

VEGF Receptor 1 Rabbit Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
Sirt5 Mouse siRNA Oligo Duplex (Locus ID 68346)
SR409430 1 Kit

Sirt5 Mouse siRNA Oligo Duplex (Locus ID 68346)

Sign In for Pricing
View Details
NELL1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-10704R-BF350 100 µL

NELL1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
IL1B Antibody
orb1178030 100 µg

IL1B Antibody

Sign In for Pricing
View Details