Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGFL1 protein

This Human IGFL1 protein spans the amino acid sequence from region 25-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGFL1, UNQ644/PRO1274, Insulin growth factor-like family member 1

UniProt

Q6UW32

Expression Region

25-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lynestrenol
TRC-L487850-5MG 5 mg

Lynestrenol

Sign In for Pricing
View Details
Human HAPSTR2 Pre-designed siRNA Set A
SI006906A 1 Each

Human HAPSTR2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Duck Variable Charge X-Linked Protein 3B (VCX3B) ELISA Kit
MBS9929160 Inquire

Duck Variable Charge X-Linked Protein 3B (VCX3B) ELISA Kit

Sign In for Pricing
View Details
Human Recombinant Protein
TP727631 10 µg

Human Recombinant Protein

Sign In for Pricing
View Details
TRMT112 Adenovirus (Mouse)
47866054 1.0 mL

TRMT112 Adenovirus (Mouse)

Sign In for Pricing
View Details
Prostate Specific Antigen, Total (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (APC)
MBS6260713-01 0.1 mL

Prostate Specific Antigen, Total (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (APC)

Sign In for Pricing
View Details