Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGFL1 protein

This Human IGFL1 protein spans the amino acid sequence from region 25-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGFL1, UNQ644/PRO1274, Insulin growth factor-like family member 1

UniProt

Q6UW32

Expression Region

25-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2-1 Antibody
E30AC635 100 µL

NKX2-1 Antibody

Sign In for Pricing
View Details
GATA2 Peptide (AAP31855)
AAP31855-100UG 100 µg

GATA2 Peptide (AAP31855)

Sign In for Pricing
View Details
MGC45491 shRNA (h) Lentiviral Particles
sc-95543-V 200 µL

MGC45491 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Olfr592 (NM_207556) Mouse Tagged ORF Clone
MG213864 10 µg

Olfr592 (NM_207556) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-12 Lipoxygenase/ALOX12 Antibody Picoband®
A02275-1 100 µg/Vial

Anti-12 Lipoxygenase/ALOX12 Antibody Picoband®

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans col-91 Polyclonal Antibody
MBS7154160 Inquire

Rabbit anti-Caenorhabditis elegans col-91 Polyclonal Antibody

Sign In for Pricing
View Details